Use and Care Manual
Page 4
...in. Freezer Shelves: To Remove Lift up and out Tilt up Insert top hook Lower to install features. (Not all features are on all models.) Rearranging the Shelves Refrigerator Shelves: To Remove To Replace Freezer Pan: To Remove To remove: Lift the front of the bin up the front...lock into position. Lower Door Bin About the shelves and bins. (Not all features are on all models.) c TOP FREEZER SHELF Make sure the shelf front locks into position. NOTE: On dispenser models, the longer shelf fronts go in the top two positions. To remove: Lift the shelf extender straight...
...in. Freezer Shelves: To Remove Lift up and out Tilt up Insert top hook Lower to install features. (Not all features are on all models.) Rearranging the Shelves Refrigerator Shelves: To Remove To Replace Freezer Pan: To Remove To remove: Lift the front of the bin up the front...lock into position. Lower Door Bin About the shelves and bins. (Not all features are on all models.) c TOP FREEZER SHELF Make sure the shelf front locks into position. NOTE: On dispenser models, the longer shelf fronts go in the top two positions. To remove: Lift the shelf extender straight...
Use and Care Manual
Page 5
... special edges are on all features are designed to help prevent spills from dripping to lower shelves. About the crispers and pans. (Not all models.) Adjustable Humidity Crispers and Snack Pan (on some cases, when you roll the refrigerator out, you will need to move the refrigerator to the...coldest setting to normal refrigerator temperature and provide extra vegetable storage space. When replacing the crispers, make sure you close the door. In some models) HIGH LOW Slide the control all the way to the High setting Slide the control all the way back in meat position for a long...
... special edges are on all features are designed to help prevent spills from dripping to lower shelves. About the crispers and pans. (Not all models.) Adjustable Humidity Crispers and Snack Pan (on some cases, when you roll the refrigerator out, you will need to move the refrigerator to the...coldest setting to normal refrigerator temperature and provide extra vegetable storage space. When replacing the crispers, make sure you close the door. In some models) HIGH LOW Slide the control all the way to the High setting Slide the control all the way back in meat position for a long...
Use and Care Manual
Page 6
... the refrigerator to the 0 (off) setting via the controls does not shut off cooling in the image. About Energy Smart™ Models Controls Energy Smart™ is receiving utility rate information, then Energy Smart™ feature alters the performance of the refrigerator. Eighteen hours ...usage and operating conditions and may vary slightly from altering the performance of your refrigerator and is located on the right side of models equipped with the feature, as the actual temperature in both displays flash "0". Control settings will continue normal operation. What Energy ...
... the refrigerator to the 0 (off) setting via the controls does not shut off cooling in the image. About Energy Smart™ Models Controls Energy Smart™ is receiving utility rate information, then Energy Smart™ feature alters the performance of the refrigerator. Eighteen hours ...usage and operating conditions and may vary slightly from altering the performance of your refrigerator and is located on the right side of models equipped with the feature, as the actual temperature in both displays flash "0". Control settings will continue normal operation. What Energy ...
Use and Care Manual
Page 7
... lift past the stop position. Backed-up ice can jam the chute or cause the door in the ice storage bin. It is dispensed, some models.) GEAppliances.com Spill Shelf To Use the Dispenser Select or Press the glass gently against the top of narrow glasses. If ice is blocking the... drawer, make sure to push it and rotate the drive mechanism 1/4 turn. If ice is not used frequently, old ice cubes will form on Dispenser Models To remove: Slide the icemaker power switch to the OFF position. Rotate Drive Mechanism Important Facts About Your Dispenser Do not add ice from...
... lift past the stop position. Backed-up ice can jam the chute or cause the door in the ice storage bin. It is dispensed, some models.) GEAppliances.com Spill Shelf To Use the Dispenser Select or Press the glass gently against the top of narrow glasses. If ice is blocking the... drawer, make sure to push it and rotate the drive mechanism 1/4 turn. If ice is not used frequently, old ice cubes will form on Dispenser Models To remove: Slide the icemaker power switch to the OFF position. Rotate Drive Mechanism Important Facts About Your Dispenser Do not add ice from...
Use and Care Manual
Page 8
...24-hour period, depending on Water by Culligan™ models, you are filtering your filtration system, GE recommends the use of water may drip down on some models) on models without the filter or filter bypass plug. Using GE-branded filters in Canada should be replaced when the ... filter soon. When to replace the filter on models with property damage due to water leakage, read and follow instructions before installation and use of this system. A small amount of this product. Customers in GE and Hotpoint® refrigerators provides optimal performance and ...
...24-hour period, depending on Water by Culligan™ models, you are filtering your filtration system, GE recommends the use of water may drip down on some models) on models without the filter or filter bypass plug. Using GE-branded filters in Canada should be replaced when the ... filter soon. When to replace the filter on models with property damage due to water leakage, read and follow instructions before installation and use of this system. A small amount of this product. Customers in GE and Hotpoint® refrigerators provides optimal performance and ...
Use and Care Manual
Page 9
... compartments. Before cleaning, lock the dispenser by pushing it straight in. The stainless steel door panels and handles. For best results, GE recommends using a clean, soft cloth. Cleaning the Inside To help prevent odors, leave an open . This both cleans and neutralizes ...petroleum jelly to a quart (1 l) of water. If drain becomes clogged, use appliance wax, polish, bleach or products containing chlorine on some models). Moving the refrigerator in a side direction may leave a residue that can be cleaned with a commercially available stainless steel cleaner or a similar...
... compartments. Before cleaning, lock the dispenser by pushing it straight in. The stainless steel door panels and handles. For best results, GE recommends using a clean, soft cloth. Cleaning the Inside To help prevent odors, leave an open . This both cleans and neutralizes ...petroleum jelly to a quart (1 l) of water. If drain becomes clogged, use appliance wax, polish, bleach or products containing chlorine on some models). Moving the refrigerator in a side direction may leave a residue that can be cleaned with a commercially available stainless steel cleaner or a similar...
Use and Care Manual
Page 10
... is used.) After one or two turns of the wrench, open the doors and then pull the grille straight out. Ý6RFNHW Wrench Raise A GE water supply kit is available at extra cost from your dealer, by pulling it on back of grille between the bar and the bottom of... door opening which provides better access to maintain proper temperatures. • Install it out at : GEAppliances.com Questions? WATER SUPPLY TO THE ICEMAKER (on some models) If the refrigerator has an icemaker, it . In Canada, call 1.800.561.3344 or Visit our Website at the top. Observe all governing codes and...
... is used.) After one or two turns of the wrench, open the doors and then pull the grille straight out. Ý6RFNHW Wrench Raise A GE water supply kit is available at extra cost from your dealer, by pulling it on back of grille between the bar and the bottom of... door opening which provides better access to maintain proper temperatures. • Install it out at : GEAppliances.com Questions? WATER SUPPLY TO THE ICEMAKER (on some models) If the refrigerator has an icemaker, it . In Canada, call 1.800.561.3344 or Visit our Website at the top. Observe all governing codes and...
Use and Care Manual
Page 11
...™ Refrigerator Tubing Kits are GE SmartConnect™ Refrigerator Tubing (WX08X10002, WX08X10006, WX08X10015 and WX08X10025). Saddle-type shutoff valves are using copper, be between 20 and 120 p.s.i. (1.4-8.2 bar) on models without a water filter and between 40 and 120 p.s.i. (2.8-8.2 bar)... only. Installation Instructions INSTALLING THE WATER LINE BEFORE YOU BEGIN Recommended copper water supply kits are WX8X2, WX8X3 or WX8X4, depending on models with a water filter. • Power drill. • 1/2Ý or adjustable wrench. • Straight and Phillips blade screwdriver....
...™ Refrigerator Tubing Kits are GE SmartConnect™ Refrigerator Tubing (WX08X10002, WX08X10006, WX08X10015 and WX08X10025). Saddle-type shutoff valves are using copper, be between 20 and 120 p.s.i. (1.4-8.2 bar) on models without a water filter and between 40 and 120 p.s.i. (2.8-8.2 bar)... only. Installation Instructions INSTALLING THE WATER LINE BEFORE YOU BEGIN Recommended copper water supply kits are WX8X2, WX8X3 or WX8X4, depending on models with a water filter. • Power drill. • 1/2Ý or adjustable wrench. • Straight and Phillips blade screwdriver....
Use and Care Manual
Page 13
... TO THE REFRIGERATOR (CONT.) Tubing Clamp Ý Compression Nut Ý Tubing Ferrule (sleeve) Refrigerator Connection SmartConnect™ Tubing On models using the refrigeration connection at the end of 15°F (-9°C) or below will not begin operation automatically if the icemaker power ...sleeve) onto the end of the illustrations below . While holding the tubing, tighten the fitting. For plastic tubing from a GE SmartConnect™ Refrigerator Tubing kit, insert the molded end of the tubing into the refrigerator connection and tighten the compression nut until...
... TO THE REFRIGERATOR (CONT.) Tubing Clamp Ý Compression Nut Ý Tubing Ferrule (sleeve) Refrigerator Connection SmartConnect™ Tubing On models using the refrigeration connection at the end of 15°F (-9°C) or below will not begin operation automatically if the icemaker power ...sleeve) onto the end of the illustrations below . While holding the tubing, tighten the fitting. For plastic tubing from a GE SmartConnect™ Refrigerator Tubing kit, insert the molded end of the tubing into the refrigerator connection and tighten the compression nut until...
Use and Care Manual
Page 14
... savings. See About the controls. Review the charts on the defrost heater can cause a cracking or popping sound. On models with an icemaker, after defrost can cause a sizzling, popping or buzzing sound during the defrost cycle. A water dripping noise...off) position. • Wait about 2 hours for service. This happens when the refrigerator is • See About Energy Smart™ Models. 14 altering refrigerator performance Problem Possible Causes What To Do Refrigerator does not operate Refrigerator in , when the doors are normal. The fuse...
... savings. See About the controls. Review the charts on the defrost heater can cause a cracking or popping sound. On models with an icemaker, after defrost can cause a sizzling, popping or buzzing sound during the defrost cycle. A water dripping noise...off) position. • Wait about 2 hours for service. This happens when the refrigerator is • See About Energy Smart™ Models. 14 altering refrigerator performance Problem Possible Causes What To Do Refrigerator does not operate Refrigerator in , when the doors are normal. The fuse...
Use and Care Manual
Page 15
... Check to see if package is holding door open . Automatic icemaker does not work (on some models) Icemaker power switch is • See About Energy Smart™ Models. Temperature control not set at a time, until clumps do not form. Food transmitting odor/taste to...openings. Temperature controls set • See About the controls. Interior of freezer compartment. • This helps prevent condensation on some models) turned off frequently. (Modern refrigerators with more storage space and a larger freezer require more operating time. Adjust the freezer control to...
... Check to see if package is holding door open . Automatic icemaker does not work (on some models) Icemaker power switch is • See About Energy Smart™ Models. Temperature control not set at a time, until clumps do not form. Food transmitting odor/taste to...openings. Temperature controls set • See About the controls. Interior of freezer compartment. • This helps prevent condensation on some models) turned off frequently. (Modern refrigerators with more storage space and a larger freezer require more operating time. Adjust the freezer control to...
Use and Care Manual
Page 16
...is LOCKED. Water filter clogged. Interior needs cleaning. Defrost water drainage system needs cleaning. Cubed Ice was selected Last setting was dispensed (on some models) • A few cubes were left in the crusher from the dispenser for 3 minutes (about 11/2 gallons). • Call for service....• Allow several hours for a long time. Problem Possible Causes Water has poor taste/odor Water dispenser has not been (on some models) used for service... replace every three months. • See Care and cleaning. • See Care and cleaning. • Wipe ...
...is LOCKED. Water filter clogged. Interior needs cleaning. Defrost water drainage system needs cleaning. Cubed Ice was selected Last setting was dispensed (on some models) • A few cubes were left in the crusher from the dispenser for 3 minutes (about 11/2 gallons). • Call for service....• Allow several hours for a long time. Problem Possible Causes Water has poor taste/odor Water dispenser has not been (on some models) used for service... replace every three months. • See Care and cleaning. • See Care and cleaning. • Wipe ...
Use and Care Manual
Page 17
...replacement elements please call 1-800-626-2002 or visit our website at the rated capacity, or sooner if a noticeable reduction in model GE MWF for this ¿lter system is microbiologically unsafe or of this water filter are not necessarily in all state and local...California Department of Public Health, and replacements, see geappliances.com for Warranty information. Performance Data Sheet SmartWater™ Filtration System³GE MWF Cartridge Performance Data Information Capacity: 300 Gallons (1,135 Liters) 7KHFRQFHQWUDWLRQRIWKHFRQWDPLQDQWVWHVWHGIRUWKLV¿OWHULQ...
...replacement elements please call 1-800-626-2002 or visit our website at the rated capacity, or sooner if a noticeable reduction in model GE MWF for this ¿lter system is microbiologically unsafe or of this water filter are not necessarily in all state and local...California Department of Public Health, and replacements, see geappliances.com for Warranty information. Performance Data Sheet SmartWater™ Filtration System³GE MWF Cartridge Performance Data Information Capacity: 300 Gallons (1,135 Liters) 7KHFRQFHQWUDWLRQRIWKHFRQWDPLQDQWVWHVWHGIRUWKLV¿OWHULQ...
Use and Care Manual
Page 18
GE PROFILE MODELS ONLY: Five Years (GE Profile models only) From the date of the original purchase Any part ...connecting tubing) which fails due to a defect in materials or workmanship. For The Period Of: GE Will Replace: GE and GE PROFILE MODELS: One Year From the date of the original purchase Any part of the water filter cartridge which ... specified operating range or due to excessive sediment in the sealed refrigerating system. Please have serial number and model number available when calling for other than the intended purpose or used commercially. Loss of food ...
GE PROFILE MODELS ONLY: Five Years (GE Profile models only) From the date of the original purchase Any part ...connecting tubing) which fails due to a defect in materials or workmanship. For The Period Of: GE Will Replace: GE and GE PROFILE MODELS: One Year From the date of the original purchase Any part of the water filter cartridge which ... specified operating range or due to excessive sediment in the sealed refrigerating system. Please have serial number and model number available when calling for other than the intended purpose or used commercially. Loss of food ...
Quick Specs
Page 2
...to eat • Adjustable gallon door bins - Offers ideal space for storing gallon containers in all users' water) • Model GSE25ESHSS - Removes trace pharmaceuticals from water and ice* and uses replacement filter MWF (*Removes ibuprofen, atenolol, fluoxetine, progesterone and trimethoprim. ... Warmer Colder 0°F is Recommended Reset Filter Water Crushed Cubed Light Lock GSE22ESH_GSE25ESH As an Energy Star® partner, GE has determined that this product meets the Energy Star guidelines for quick, easy access • Adjustable-humidity drawers - These...
...to eat • Adjustable gallon door bins - Offers ideal space for storing gallon containers in all users' water) • Model GSE25ESHSS - Removes trace pharmaceuticals from water and ice* and uses replacement filter MWF (*Removes ibuprofen, atenolol, fluoxetine, progesterone and trimethoprim. ... Warmer Colder 0°F is Recommended Reset Filter Water Crushed Cubed Light Lock GSE22ESH_GSE25ESH As an Energy Star® partner, GE has determined that this product meets the Energy Star guidelines for quick, easy access • Adjustable-humidity drawers - These...
Energy Guide
Page 1
... electricity cost of 12 cents per kWh. BERG GUIDE Refrigerator-Freezer • Automatic Defrost • Side-Mounted Freezer • Through-the-Door Ice General Electric Model(s): GSE2SESH****, GSE25ETH**** Capacity: 24.7 Cubic Feet Compare ONLY to other labels with automatic defrost, side-mounted freezer, and through-the-door ice. • Estimated ... available 640 kWh Estimated Yearly Electricity Use • Your cost will depend on your utility rates and use. • Cost range based only on models of this label before consumer purchase. ENERGY STAR ftc.govienergy 245D1727P003A
... electricity cost of 12 cents per kWh. BERG GUIDE Refrigerator-Freezer • Automatic Defrost • Side-Mounted Freezer • Through-the-Door Ice General Electric Model(s): GSE2SESH****, GSE25ETH**** Capacity: 24.7 Cubic Feet Compare ONLY to other labels with automatic defrost, side-mounted freezer, and through-the-door ice. • Estimated ... available 640 kWh Estimated Yearly Electricity Use • Your cost will depend on your utility rates and use. • Cost range based only on models of this label before consumer purchase. ENERGY STAR ftc.govienergy 245D1727P003A